PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.NL359
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 255aa    MW: 29382.6 Da    PI: 4.9358
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.NL359genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.44.2e-4761361128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                  lppGfrFhPtdeelv++yLk+k++g+++el ++i+e++ y ++ +++        + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v 
  Araip.NL359   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEMNDYISKSRTFCLfleksFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVS 102
                  79****************************.99****866666666542223334455888************************************* PP

          NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  s +++ +g+kktLv+y+grap+g +tdWvmheyrl
  Araip.NL359 103 S-QSRPIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 136
                  9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-554160IPR003441NAC domain
PROSITE profilePS5100553.0136159IPR003441NAC domain
PfamPF023657.0E-307136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE MNDYISKSRT FCLFLEKSFL  60
PSRDPEWYFF GPRDRKYPNG FRTNRATRAG YWKSTGKDRR VSSQSRPIGM KKTLVYYRGR  120
APQGIRTDWV MHEYRLDDKD SEDTTGLQDT YALCRVFKKN GICTDVEEQV GHCSNMSSLI  180
ESSQTIINNN NNNSNNNNEY CETMSPDIAG VSSSCLEEED KDDSWMQFIT EDAWYSSNAP  240
NMVGGEEVSH VTFTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-47116012166NO APICAL MERISTEM PROTEIN
1ut4_B8e-47116012166NO APICAL MERISTEM PROTEIN
1ut7_A8e-47116012166NO APICAL MERISTEM PROTEIN
1ut7_B8e-47116012166NO APICAL MERISTEM PROTEIN
3swm_A9e-47116015169NAC domain-containing protein 19
3swm_B9e-47116015169NAC domain-containing protein 19
3swm_C9e-47116015169NAC domain-containing protein 19
3swm_D9e-47116015169NAC domain-containing protein 19
3swp_A9e-47116015169NAC domain-containing protein 19
3swp_B9e-47116015169NAC domain-containing protein 19
3swp_C9e-47116015169NAC domain-containing protein 19
3swp_D9e-47116015169NAC domain-containing protein 19
4dul_A8e-47116012166NAC domain-containing protein 19
4dul_B8e-47116012166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015967009.11e-170PREDICTED: NAC domain-containing protein 86
RefseqXP_016200867.11e-170PREDICTED: NAC domain-containing protein 86
SwissprotQ9FFI56e-77NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A151T3V11e-149A0A151T3V1_CAJCA; NAC domain-containing protein 78
TrEMBLK7LEC21e-148K7LEC2_SOYBN; Uncharacterized protein
STRINGGLYMA09G29760.21e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-121NAC domain containing protein 57